Lineage for d1nh8a2 (1nh8 A:211-284)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557713Family d.58.5.3: ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [88851] (1 protein)
    automatically mapped to Pfam PF08029
  6. 2557714Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [82669] (2 species)
    binds allosteric inhibitor histidine
  7. 2557718Species Mycobacterium tuberculosis [TaxId:1773] [82670] (2 PDB entries)
  8. 2557719Domain d1nh8a2: 1nh8 A:211-284 [80508]
    Other proteins in same PDB: d1nh8a1
    complexed with amp, his, so4

Details for d1nh8a2

PDB Entry: 1nh8 (more details), 1.8 Å

PDB Description: atp phosphoribosyltransferase (atp-prtase) from mycobacterium tuberculosis in complex with amp and histidine
PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d1nh8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nh8a2 d.58.5.3 (A:211-284) ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
qylmldydcprsalkkataitpglesptiapladpdwvairalvprrdvngimdelaaig
akailasdirfcrf

SCOPe Domain Coordinates for d1nh8a2:

Click to download the PDB-style file with coordinates for d1nh8a2.
(The format of our PDB-style files is described here.)

Timeline for d1nh8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nh8a1