SCOPe 2.04: Domain d1nh8a2: 1nh8 A:211-284

Lineage for d1nh8a2 (1nh8 A:211-284)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.3: ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [88851] (1 protein)
   automatically mapped to Pfam PF08029

6. Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [82669] (2 species)
   binds allosteric inhibitor histidine

7. Species Mycobacterium tuberculosis [TaxId:1773] [82670] (2 PDB entries)

8. Domain d1nh8a2: 1nh8 A:211-284 [80508]
   Other proteins in same PDB: d1nh8a1
   complexed with amp, his, so4

Details for d1nh8a2

PDB Entry: 1nh8, 1.8 Å

PDB Description: atp phosphoribosyltransferase (atp-prtase) from mycobacterium tuberculosis in complex with amp and histidine

PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d1nh8a2:

Sequence; same for both SEQRES and ATOM records:

>d1nh8a2 d.58.5.3 (A:211-284) ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
qylmldydcprsalkkataitpglesptiapladpdwvairalvprrdvngimdelaaig
akailasdirfcrf

Timeline for d1nh8a2:

• d1nh8a2 first appeared in SCOP 1.63
  
• d1nh8a2 appears in SCOPe 2.03
  
• d1nh8a2 appears in SCOPe 2.05
  
• d1nh8a2 appears in the current release, SCOPe 2.08