Lineage for d1nh8a1 (1nh8 A:1-210)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144312Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species)
    there is an additional C-terminal allosteric domain in some species
  7. 2144325Species Mycobacterium tuberculosis [TaxId:1773] [82560] (2 PDB entries)
  8. 2144326Domain d1nh8a1: 1nh8 A:1-210 [80507]
    Other proteins in same PDB: d1nh8a2
    complexed with amp, his, so4

Details for d1nh8a1

PDB Entry: 1nh8 (more details), 1.8 Å

PDB Description: atp phosphoribosyltransferase (atp-prtase) from mycobacterium tuberculosis in complex with amp and histidine
PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d1nh8a1:

Sequence, based on SEQRES records: (download)

>d1nh8a1 c.94.1.1 (A:1-210) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
mlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvgsg
eldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypnlv
rkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdseav
lieragtdgqdqteardqlvarvqgvvfgq

Sequence, based on observed residues (ATOM records): (download)

>d1nh8a1 c.94.1.1 (A:1-210) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
mlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvgsg
eldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypnlv
rkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdseav
lieraeardqlvarvqgvvfgq

SCOPe Domain Coordinates for d1nh8a1:

Click to download the PDB-style file with coordinates for d1nh8a1.
(The format of our PDB-style files is described here.)

Timeline for d1nh8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nh8a2