SCOP 1.69: Domain d1ngzb1: 1ngz B:1-114

Lineage for d1ngzb1 (1ngz B:1-114)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d1ngzb1: 1ngz B:1-114 [80502]
   Other proteins in same PDB: d1ngza1, d1ngza2, d1ngzb2
   part of metal chelatase catalytic Fab 7G12; chimeric germline antibody

Details for d1ngzb1

PDB Entry: 1ngz, 1.6 Å

PDB Description: Chimeric Germline Fab 7g12-apo

SCOP Domain Sequences for d1ngzb1:

Sequence; same for both SEQRES and ATOM records:

>d1ngzb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyyctrrdsdywgagttvtvss

Timeline for d1ngzb1:

• d1ngzb1 first appeared in SCOP 1.63
  
• d1ngzb1 appears in SCOP 1.67
  
• d1ngzb1 appears in SCOP 1.71
  
• d1ngzb1 appears in the current release, SCOPe 2.08