SCOP 1.71: Domain d1ngza2: 1ngz A:108-213

Lineage for d1ngza2 (1ngz A:108-213)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1ngza2: 1ngz A:108-213 [80501]
   Other proteins in same PDB: d1ngza1, d1ngzb1, d1ngzb2
   part of metal chelatase catalytic Fab 7G12; chimeric germline antibody

Details for d1ngza2

PDB Entry: 1ngz, 1.6 Å

PDB Description: Chimeric Germline Fab 7g12-apo

SCOP Domain Sequences for d1ngza2:

Sequence; same for both SEQRES and ATOM records:

>d1ngza2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d1ngza2:

• d1ngza2 first appeared in SCOP 1.63
  
• d1ngza2 appears in SCOP 1.69
  
• d1ngza2 appears in SCOP 1.73
  
• d1ngza2 appears in the current release, SCOPe 2.08