Lineage for d1ngyb1 (1ngy B:1-114)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220140Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [48879] (5 PDB entries)
  8. 220150Domain d1ngyb1: 1ngy B:1-114 [80498]
    Other proteins in same PDB: d1ngya2, d1ngyb2
    chimeric mature antibody

Details for d1ngyb1

PDB Entry: 1ngy (more details), 2.2 Å

PDB Description: Chimeric Mature Fab 7g12-Apo
PDB Compounds: (B:)

SCOP Domain Sequences for d1ngyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngyb1 b.1.1.1 (B:1-114) Immunoglobulin (variable domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain}
qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvss

SCOP Domain Coordinates for d1ngyb1:

Click to download the PDB-style file with coordinates for d1ngyb1.
(The format of our PDB-style files is described here.)

Timeline for d1ngyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngyb2