Lineage for d1ngya1 (1ngy A:1-107)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547739Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)
  8. 547944Domain d1ngya1: 1ngy A:1-107 [80496]
    Other proteins in same PDB: d1ngya2, d1ngyb1, d1ngyb2
    part of metal chelatase catalytic Fab 7G12; chimeric mature antibody

Details for d1ngya1

PDB Entry: 1ngy (more details), 2.2 Å

PDB Description: Chimeric Mature Fab 7g12-Apo

SCOP Domain Sequences for d1ngya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngya1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveik

SCOP Domain Coordinates for d1ngya1:

Click to download the PDB-style file with coordinates for d1ngya1.
(The format of our PDB-style files is described here.)

Timeline for d1ngya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngya2