SCOP 1.65: Domain d1ngya1: 1ngy A:1-107

Lineage for d1ngya1 (1ngy A:1-107)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)

8. Domain d1ngya1: 1ngy A:1-107 [80496]
   Other proteins in same PDB: d1ngya2, d1ngyb1, d1ngyb2
   part of metal chelatase catalytic Fab 7G12; chimeric mature antibody

Details for d1ngya1

PDB Entry: 1ngy, 2.2 Å

PDB Description: Chimeric Mature Fab 7g12-Apo

SCOP Domain Sequences for d1ngya1:

Sequence; same for both SEQRES and ATOM records:

>d1ngya1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveik

Timeline for d1ngya1:

• d1ngya1 first appeared in SCOP 1.63
  
• d1ngya1 appears in SCOP 1.67
  
• d1ngya1 appears in the current release, SCOPe 2.08