Lineage for d1ngwl2 (1ngw L:108-213)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221893Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [49089] (5 PDB entries)
  8. 221907Domain d1ngwl2: 1ngw L:108-213 [80495]
    Other proteins in same PDB: d1ngwa1, d1ngwb1, d1ngwh1, d1ngwl1

Details for d1ngwl2

PDB Entry: 1ngw (more details), 2.6 Å

PDB Description: chimeric affinity matured fab 7g12 complexed with mesoporphyrin

SCOP Domain Sequences for d1ngwl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngwl2 b.1.1.2 (L:108-213) Immunoglobulin (constant domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

SCOP Domain Coordinates for d1ngwl2:

Click to download the PDB-style file with coordinates for d1ngwl2.
(The format of our PDB-style files is described here.)

Timeline for d1ngwl2: