SCOPe 2.04: Domain d1ngwh2: 1ngw H:115-216

Lineage for d1ngwh2 (1ngw H:115-216)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1ngwh2: 1ngw H:115-216 [80493]
   Other proteins in same PDB: d1ngwa1, d1ngwa2, d1ngwb1, d1ngwh1, d1ngwl1, d1ngwl2
   part of metal chelatase catalytic Fab 7G12; chimeric affinity matured antibody
   complexed with mmp

Details for d1ngwh2

PDB Entry: 1ngw, 2.6 Å

PDB Description: chimeric affinity matured fab 7g12 complexed with mesoporphyrin

PDB Compounds: (H:) Mature Metal Chelatase Catalytic Antibody, Heavy chain

SCOPe Domain Sequences for d1ngwh2:

Sequence; same for both SEQRES and ATOM records:

>d1ngwh2 b.1.1.2 (H:115-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkivpks

Timeline for d1ngwh2:

• d1ngwh2 first appeared in SCOP 1.63
  
• d1ngwh2 appears in SCOPe 2.03
  
• d1ngwh2 appears in SCOPe 2.05
  
• d1ngwh2 appears in the current release, SCOPe 2.08