SCOP 1.65: Domain d1ngwb2: 1ngw B:115-216

Lineage for d1ngwb2 (1ngw B:115-216)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1ngwb2: 1ngw B:115-216 [80491]
   Other proteins in same PDB: d1ngwa1, d1ngwa2, d1ngwb1, d1ngwh1, d1ngwl1, d1ngwl2

Details for d1ngwb2

PDB Entry: 1ngw, 2.6 Å

PDB Description: chimeric affinity matured fab 7g12 complexed with mesoporphyrin

SCOP Domain Sequences for d1ngwb2:

Sequence; same for both SEQRES and ATOM records:

>d1ngwb2 b.1.1.2 (B:115-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkivpks

Timeline for d1ngwb2:

• d1ngwb2 first appeared in SCOP 1.63
  
• d1ngwb2 appears in SCOP 1.67
  
• d1ngwb2 appears in the current release, SCOPe 2.08