SCOP 1.67: Domain d1ngwb1: 1ngw B:1-114

Lineage for d1ngwb1 (1ngw B:1-114)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries)

8. Domain d1ngwb1: 1ngw B:1-114 [80490]
   Other proteins in same PDB: d1ngwa1, d1ngwa2, d1ngwb2, d1ngwh2, d1ngwl1, d1ngwl2

Details for d1ngwb1

PDB Entry: 1ngw, 2.6 Å

PDB Description: chimeric affinity matured fab 7g12 complexed with mesoporphyrin

SCOP Domain Sequences for d1ngwb1:

Sequence; same for both SEQRES and ATOM records:

>d1ngwb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvss

Timeline for d1ngwb1:

• d1ngwb1 first appeared in SCOP 1.63
  
• d1ngwb1 appears in SCOP 1.65
  
• d1ngwb1 appears in SCOP 1.69
  
• d1ngwb1 appears in the current release, SCOPe 2.08