Lineage for d1ng9b4 (1ng9 B:9-116)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414051Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 414074Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 414075Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 414076Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 414077Species Escherichia coli [TaxId:562] [55275] (6 PDB entries)
  8. 414083Domain d1ng9b4: 1ng9 B:9-116 [80487]
    Other proteins in same PDB: d1ng9a1, d1ng9a2, d1ng9a3, d1ng9b1, d1ng9b2, d1ng9b3
    complexed with adp, mo6; mutant

Details for d1ng9b4

PDB Entry: 1ng9 (more details), 2.6 Å

PDB Description: E.coli MutS R697A: an ATPase-asymmetry mutant

SCOP Domain Sequences for d1ng9b4:

Sequence, based on SEQRES records: (download)

>d1ng9b4 d.75.2.1 (B:9-116) DNA repair protein MutS, domain I {Escherichia coli}
ahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipm
agipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Sequence, based on observed residues (ATOM records): (download)

>d1ng9b4 d.75.2.1 (B:9-116) DNA repair protein MutS, domain I {Escherichia coli}
ahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpipmagipyhav
enylaklvnqgesvaiceqverkvvrivtp

SCOP Domain Coordinates for d1ng9b4:

Click to download the PDB-style file with coordinates for d1ng9b4.
(The format of our PDB-style files is described here.)

Timeline for d1ng9b4: