Lineage for d1ng9a2 (1ng9 A:567-800)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 485179Family c.37.1.12: ABC transporter ATPase domain-like [52686] (17 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 485217Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 485218Species Escherichia coli [TaxId:562] [52699] (7 PDB entries)
  8. 485225Domain d1ng9a2: 1ng9 A:567-800 [80481]
    Other proteins in same PDB: d1ng9a1, d1ng9a3, d1ng9a4, d1ng9b1, d1ng9b3, d1ng9b4

Details for d1ng9a2

PDB Entry: 1ng9 (more details), 2.6 Å

PDB Description: E.coli MutS R697A: an ATPase-asymmetry mutant

SCOP Domain Sequences for d1ng9a2:

Sequence, based on SEQRES records: (download)

>d1ng9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigagtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records): (download)

>d1ng9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgagrstfmvemtetanilhnateyslvlm
deigagtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldaleh
gdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

SCOP Domain Coordinates for d1ng9a2:

Click to download the PDB-style file with coordinates for d1ng9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ng9a2: