SCOP 1.65: Domain d1ng9a2: 1ng9 A:567-800

Lineage for d1ng9a2 (1ng9 A:567-800)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (14 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)

7. Species Escherichia coli [TaxId:562] [52699] (2 PDB entries)

8. Domain d1ng9a2: 1ng9 A:567-800 [80481]
   Other proteins in same PDB: d1ng9a1, d1ng9a3, d1ng9a4, d1ng9b1, d1ng9b3, d1ng9b4

Details for d1ng9a2

PDB Entry: 1ng9, 2.6 Å

PDB Description: e.coli muts r697a: an atpase-asymmetry mutant

SCOP Domain Sequences for d1ng9a2:

Sequence, based on SEQRES records:

>d1ng9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigagtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records):

>d1ng9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgagrstfmvemtetanilhnateyslvlm
deigagtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldaleh
gdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Timeline for d1ng9a2:

• d1ng9a2 first appeared in SCOP 1.63
  
• d1ng9a2 appears in SCOP 1.67
  
• d1ng9a2 appears in the current release, SCOPe 2.08