Lineage for d1ng9a1 (1ng9 A:270-566)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338214Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 2338215Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) (S)
  5. 2338216Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 2338217Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 2338218Species Escherichia coli [TaxId:562] [48338] (8 PDB entries)
    Uniprot P23909 2-800
  8. 2338226Domain d1ng9a1: 1ng9 A:270-566 [80480]
    Other proteins in same PDB: d1ng9a2, d1ng9a3, d1ng9a4, d1ng9b2, d1ng9b3, d1ng9b4
    complexed with adp, mg; mutant

Details for d1ng9a1

PDB Entry: 1ng9 (more details), 2.6 Å

PDB Description: e.coli muts r697a: an atpase-asymmetry mutant
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1ng9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng9a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOPe Domain Coordinates for d1ng9a1:

Click to download the PDB-style file with coordinates for d1ng9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ng9a1: