Lineage for d1ng0c_ (1ng0 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822375Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)
  6. 2822386Protein Sobemovirus coat protein [88644] (4 species)
  7. 2822387Species Cocksfoot mottle virus [TaxId:40979] [82010] (1 PDB entry)
  8. 2822390Domain d1ng0c_: 1ng0 C: [80477]
    complexed with ca

Details for d1ng0c_

PDB Entry: 1ng0 (more details), 2.7 Å

PDB Description: the three-dimensional structure of cocksfoot mottle virus at 2.7a resolution
PDB Compounds: (C:) coat protein

SCOPe Domain Sequences for d1ng0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng0c_ b.121.4.7 (C:) Sobemovirus coat protein {Cocksfoot mottle virus [TaxId: 40979]}
vsrplnppaavgstlkagrgrtagvsdwfdtgmitsylggfqrtagttdsqvfivspaal
drvgtiakayalwrpkhweivylprcstqtdgsiemgflldyadsvptntrtmasstsft
tsnvwgggdgssllhtsmksmgnavtsalpcdefsnkwfklswstpeesenahltdtyvp
arfvvrsdfpvvtadqpghlwlrsrillkgsvspstnl

SCOPe Domain Coordinates for d1ng0c_:

Click to download the PDB-style file with coordinates for d1ng0c_.
(The format of our PDB-style files is described here.)

Timeline for d1ng0c_: