Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Coagulation factor Xa, protease domain [50574] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50575] (57 PDB entries) Uniprot P00742 235-467 |
Domain d1nfwa_: 1nfw A: [80469] Other proteins in same PDB: d1nfwb_ complexed with ca, rrr |
PDB Entry: 1nfw (more details), 2.1 Å
SCOPe Domain Sequences for d1nfwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfwa_ b.47.1.2 (A:) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt
Timeline for d1nfwa_: