Lineage for d1nfrb_ (1nfr B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451058Protein Putative oxidoreductase Rv2002 [82292] (1 species)
  7. 2451059Species Mycobacterium tuberculosis [TaxId:1773] [82293] (3 PDB entries)
  8. 2451063Domain d1nfrb_: 1nfr B: [80464]
    complexed with nad

Details for d1nfrb_

PDB Entry: 1nfr (more details), 2.1 Å

PDB Description: rv2002 gene product from mycobacterium tuberculosis
PDB Compounds: (B:) Putative oxidoreductase Rv2002

SCOPe Domain Sequences for d1nfrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfrb_ c.2.1.2 (B:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]}
sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld
vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir
avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi
hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag
lahn

SCOPe Domain Coordinates for d1nfrb_:

Click to download the PDB-style file with coordinates for d1nfrb_.
(The format of our PDB-style files is described here.)

Timeline for d1nfrb_: