Lineage for d1nfqb_ (1nfq B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308075Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (33 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 308393Protein Putative oxidoreductase Rv2002 [82292] (1 species)
  7. 308394Species Mycobacterium tuberculosis [TaxId:1773] [82293] (3 PDB entries)
  8. 308402Domain d1nfqb_: 1nfq B: [80460]

Details for d1nfqb_

PDB Entry: 1nfq (more details), 2.4 Å

PDB Description: rv2002 gene product from mycobacterium tuberculosis

SCOP Domain Sequences for d1nfqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfqb_ c.2.1.2 (B:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis}
sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld
vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir
avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi
hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag
lahn

SCOP Domain Coordinates for d1nfqb_:

Click to download the PDB-style file with coordinates for d1nfqb_.
(The format of our PDB-style files is described here.)

Timeline for d1nfqb_: