![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein Putative oxidoreductase Rv2002 [82292] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [82293] (3 PDB entries) |
![]() | Domain d1nffb_: 1nff B: [80458] structural genomics complexed with nad; mutant |
PDB Entry: 1nff (more details), 1.8 Å
SCOP Domain Sequences for d1nffb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nffb_ c.2.1.2 (B:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} sgrltgkvalvsggargmgashvramvaegakvvfgdildeegkamaaeladaaryvhld vtqpaqwkaavdtavtafgglhvlvnnagilnigtiedyaltewqrildvnltgvflgir avvkpmkeagrgsiinissieglagtvachgytatkfavrgltkstalelgpsgirvnsi hpglvktpmtdwvpedifqtalgraaepvevsnlvvylasdessystgaefvvdggtvag lahn
Timeline for d1nffb_: