SCOPe 2.01: Domain d1nf0b_: 1nf0 B:

Lineage for d1nf0b_ (1nf0 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (7 PDB entries)

8. Domain d1nf0b_: 1nf0 B: [80452]
   complexed with 13p

Details for d1nf0b_

PDB Entry: 1nf0, 1.6 Å

PDB Description: triosephosphate isomerase in complex with dhap

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1nf0b_:

Sequence; same for both SEQRES and ATOM records:

>d1nf0b_ c.1.1.1 (B:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakyvilghserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdftnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn

Timeline for d1nf0b_:

• d1nf0b_ first appeared in SCOP 1.63
  
• d1nf0b_ appears in SCOP 1.75
  
• d1nf0b_ appears in SCOPe 2.02
  
• d1nf0b_ appears in the current release, SCOPe 2.08