Lineage for d1neya_ (1ney A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814175Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 814176Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 814177Protein Triosephosphate isomerase [51353] (18 species)
  7. 814192Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (7 PDB entries)
  8. 814193Domain d1neya_: 1ney A: [80449]

Details for d1neya_

PDB Entry: 1ney (more details), 1.2 Å

PDB Description: triosephosphate isomerase in complex with dhap
PDB Compounds: (A:) triosephosphate isomerase

SCOP Domain Sequences for d1neya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1neya_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakyvilghserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdftnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn

SCOP Domain Coordinates for d1neya_:

Click to download the PDB-style file with coordinates for d1neya_.
(The format of our PDB-style files is described here.)

Timeline for d1neya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1neyb_