Lineage for d1nexd1 (1nex D:270-369)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735529Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 2735530Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 2735531Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 2735532Protein Cdc4 F-box and linker domains [81912] (1 species)
  7. 2735533Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81913] (2 PDB entries)
  8. 2735535Domain d1nexd1: 1nex D:270-369 [80447]
    Other proteins in same PDB: d1nexa1, d1nexa2, d1nexb2, d1nexc1, d1nexc2, d1nexd2

Details for d1nexd1

PDB Entry: 1nex (more details), 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex
PDB Compounds: (D:) CDC4 protein

SCOPe Domain Sequences for d1nexd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nexd1 a.158.1.1 (D:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkllisenfvspk
gfnslnlklsqkypklsqqdrlrlsflenifilknwynpk

SCOPe Domain Coordinates for d1nexd1:

Click to download the PDB-style file with coordinates for d1nexd1.
(The format of our PDB-style files is described here.)

Timeline for d1nexd1: