Lineage for d1nexb2 (1nex B:370-744)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2066020Protein Cdc4 propeller domain [82169] (1 species)
    8-bladed beta-propeller without perfect 8-fold symmetry
  7. 2066021Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82170] (2 PDB entries)
  8. 2066024Domain d1nexb2: 1nex B:370-744 [80444]
    Other proteins in same PDB: d1nexa1, d1nexa2, d1nexb1, d1nexc1, d1nexc2, d1nexd1

Details for d1nexb2

PDB Entry: 1nex (more details), 2.7 Å

PDB Description: Crystal Structure of ScSkp1-ScCdc4-CPD peptide complex
PDB Compounds: (B:) CDC4 protein

SCOPe Domain Sequences for d1nexb2:

Sequence, based on SEQRES records: (download)

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fvpqrttlrghmtsvitclqfednyvitgaddkmirvydsinkkfllqlsghdggvwalk
yahggilvsgstdrtvrvwdikkgccthvfeghnstvrcldiveyknikyivtgsrdntl
hvwklpkessvpdhgeehdyplvfhtpeenpyfvgvlrghmasvrtvsghgnivvsgsyd
ntlivwdvaqmkclyilsghtdriystiydherkrcisasmdttiriwdlengelmytlq
ghtalvgllrlsdkflvsaaadgsirgwdandysrkfsyhhtnlsaittfyvsdnilvsg
senqfniynlrsgklvhanilkdadqiwsvnfkgktlvaavekdgqsfleildfs

Sequence, based on observed residues (ATOM records): (download)

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fvpqrttlrghmtsvitclqfednyvitgaddkmirvydsinkkfllqlsghdggvwalk
yahggilvsgstdrtvrvwdikkgccthvfeghnstvrcldiveyknikyivtgsrdntl
hvwklpkdyplvfhtpeenpyfvgvlrghmasvrtvsghgnivvsgsydntlivwdvaqm
kclyilsghtdriystiydherkrcisasmdttiriwdlengelmytlqghtalvgllrl
sdkflvsaaadgsirgwdandysrkfsyhhtnlsaittfyvsdnilvsgsenqfniynlr
sgklvhanilkdadqiwsvnfkgktlvaavekdgqsfleildfs

SCOPe Domain Coordinates for d1nexb2:

Click to download the PDB-style file with coordinates for d1nexb2.
(The format of our PDB-style files is described here.)

Timeline for d1nexb2: