![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.7: ML domain [81287] (3 proteins) implicated in lipid recognition, particularly in the recognition of pathogen related products automatically mapped to Pfam PF02221 |
![]() | Protein Epididymal secretory protein E1 (Niemann-Pick C2 protein) [81964] (1 species) a cholesterol binding protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81965] (2 PDB entries) |
![]() | Domain d1nepa_: 1nep A: [80440] complexed with nag, po4 |
PDB Entry: 1nep (more details), 1.7 Å
SCOPe Domain Sequences for d1nepa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nepa_ b.1.18.7 (A:) Epididymal secretory protein E1 (Niemann-Pick C2 protein) {Cow (Bos taurus) [TaxId: 9913]} epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff cwqipievea
Timeline for d1nepa_: