Lineage for d1nepa_ (1nep A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456439Family b.1.18.7: ML domain [81287] (2 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
  6. 456440Protein Epididymal secretory protein E1 (Niemann-Pick C2 protein) [81964] (1 species)
    a cholesterol binding protein
  7. 456441Species Cow (Bos taurus) [TaxId:9913] [81965] (1 PDB entry)
  8. 456442Domain d1nepa_: 1nep A: [80440]

Details for d1nepa_

PDB Entry: 1nep (more details), 1.7 Å

PDB Description: crystal structure analysis of the bovine npc2 (niemann-pick c2) protein

SCOP Domain Sequences for d1nepa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nepa_ b.1.18.7 (A:) Epididymal secretory protein E1 (Niemann-Pick C2 protein) {Cow (Bos taurus)}
epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
cwqipievea

SCOP Domain Coordinates for d1nepa_:

Click to download the PDB-style file with coordinates for d1nepa_.
(The format of our PDB-style files is described here.)

Timeline for d1nepa_: