Lineage for d1nend_ (1nen D:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697409Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1697498Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 1697516Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 1697582Protein Succinate dehydrogenase subunit SdhD [82872] (1 species)
    membrane anchor protein
  7. 1697583Species Escherichia coli [TaxId:562] [82873] (6 PDB entries)
  8. 1697594Domain d1nend_: 1nen D: [80439]
    Other proteins in same PDB: d1nena1, d1nena2, d1nena3, d1nenb1, d1nenb2, d1nenc_
    complexed with ca, cdn, dnt, eph, f3s, fad, fes, hem, oaa, sf4

Details for d1nend_

PDB Entry: 1nen (more details), 2.9 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Dinitrophenol-17 inhibitor co-crystallized at the ubiquinone binding site
PDB Compounds: (D:) Succinate dehydrogenase hydrophobic membrane anchor protein

SCOPe Domain Sequences for d1nend_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nend_ f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]}
snasalgrngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftl
lalfsilihawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv

SCOPe Domain Coordinates for d1nend_:

Click to download the PDB-style file with coordinates for d1nend_.
(The format of our PDB-style files is described here.)

Timeline for d1nend_: