![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
![]() | Protein Succinate dehydrogenase subunit SdhC [82870] (1 species) Cytochrome b556 subunit |
![]() | Species Escherichia coli [TaxId:562] [82871] (2 PDB entries) |
![]() | Domain d1nenc_: 1nen C: [80438] Other proteins in same PDB: d1nena1, d1nena2, d1nena3, d1nenb1, d1nenb2, d1nend_ |
PDB Entry: 1nen (more details), 2.9 Å
SCOP Domain Sequences for d1nenc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nenc_ f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Escherichia coli} mirnvkkqrpvnldlqtirfpitaiasilhrvsgvitfvavgillwllgtslsspegfeq asaimgsffvkfimwgiltalayhvvvgirhmmmdfgyleetfeagkrsakisfvitvvl sllagvlvw
Timeline for d1nenc_: