Lineage for d1nenb1 (1nen B:107-238)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 531937Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
    contains two Fe4-S4 clusters
  5. 531938Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)
  6. 531956Protein Succinate dehydogenase [81669] (1 species)
  7. 531957Species Escherichia coli [TaxId:562] [81670] (2 PDB entries)
  8. 531959Domain d1nenb1: 1nen B:107-238 [80436]
    Other proteins in same PDB: d1nena1, d1nena2, d1nena3, d1nenb2, d1nenc_, d1nend_
    complexed with ca, cdn, dnt, eph, f3s, fad, fes, fs4, hem, oaa

Details for d1nenb1

PDB Entry: 1nen (more details), 2.9 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Dinitrophenol-17 inhibitor co-crystallized at the ubiquinone binding site

SCOP Domain Sequences for d1nenb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nenb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOP Domain Coordinates for d1nenb1:

Click to download the PDB-style file with coordinates for d1nenb1.
(The format of our PDB-style files is described here.)

Timeline for d1nenb1: