Lineage for d1nena3 (1nen A:236-355)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614271Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 614272Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 614273Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 614331Protein Succinate dehydogenase [82818] (1 species)
  7. 614332Species Escherichia coli [TaxId:562] [82819] (2 PDB entries)
  8. 614334Domain d1nena3: 1nen A:236-355 [80435]
    Other proteins in same PDB: d1nena1, d1nena2, d1nenb1, d1nenb2, d1nenc_, d1nend_
    complexed with ca, cdn, dnt, eph, f3s, fad, fes, fs4, hem, oaa

Details for d1nena3

PDB Entry: 1nen (more details), 2.9 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Dinitrophenol-17 inhibitor co-crystallized at the ubiquinone binding site

SCOP Domain Sequences for d1nena3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nena3 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli}
memwqfhptgiagagvlvtegcrgeggyllnkhgerfmeryapnakdlagrdvvarsimi
eiregrgcdgpwgphaklkldhlgkevlesrlpgilelsrtfahvdpvkepipviptchy

SCOP Domain Coordinates for d1nena3:

Click to download the PDB-style file with coordinates for d1nena3.
(The format of our PDB-style files is described here.)

Timeline for d1nena3: