Lineage for d1nena1 (1nen A:451-588)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211240Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 211274Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 211275Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 211304Protein Succinate dehydogenase [81708] (1 species)
  7. 211305Species Escherichia coli [TaxId:562] [81709] (2 PDB entries)
  8. 211307Domain d1nena1: 1nen A:451-588 [80433]
    Other proteins in same PDB: d1nena2, d1nena3, d1nenb1, d1nenb2, d1nenc_, d1nend_
    complexed with ca, cdn, dnt, eph, f3s, fad, fes, fs4, hem, oaa

Details for d1nena1

PDB Entry: 1nen (more details), 2.9 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Dinitrophenol-17 inhibitor co-crystallized at the ubiquinone binding site

SCOP Domain Sequences for d1nena1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nena1 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli}
rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr
vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs
vnmepklrpafppkirty

SCOP Domain Coordinates for d1nena1:

Click to download the PDB-style file with coordinates for d1nena1.
(The format of our PDB-style files is described here.)

Timeline for d1nena1: