![]() | Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
![]() | Protein Succinate dehydrogenase subunit SdhC [82870] (1 species) Cytochrome b556 subunit |
![]() | Species Escherichia coli [TaxId:562] [82871] (2 PDB entries) |
![]() | Domain d1nekc_: 1nek C: [80431] Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb1, d1nekb2, d1nekd_ complexed with ca, cdn, eph, f3s, fad, fes, fs4, hem, oaa, uq2 |
PDB Entry: 1nek (more details), 2.6 Å
SCOP Domain Sequences for d1nekc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nekc_ f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Escherichia coli} mirnvkkqrpvnldlqtirfpitaiasilhrvsgvitfvavgillwllgtslsspegfeq asaimgsffvkfimwgiltalayhvvvgirhmmmdfgyleetfeagkrsakisfvitvvl sllagvlvw
Timeline for d1nekc_: