Lineage for d1nekb2 (1nek B:1-106)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717622Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 717731Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
  6. 717812Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (1 species)
  7. 717813Species Escherichia coli [TaxId:562] [82587] (3 PDB entries)
  8. 717814Domain d1nekb2: 1nek B:1-106 [80430]
    Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb1, d1nekc_, d1nekd_
    complexed with ca, cdn, eph, f3s, fad, fes, fs4, hem, oaa, uq2

Details for d1nekb2

PDB Entry: 1nek (more details), 2.6 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound
PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOP Domain Sequences for d1nekb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc
gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd

SCOP Domain Coordinates for d1nekb2:

Click to download the PDB-style file with coordinates for d1nekb2.
(The format of our PDB-style files is described here.)

Timeline for d1nekb2: