SCOP 1.71: Domain d1nekb2: 1nek B:1-106

Lineage for d1nekb2 (1nek B:1-106)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (12 proteins)

6. Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (1 species)

7. Species Escherichia coli [TaxId:562] [82587] (2 PDB entries)

8. Domain d1nekb2: 1nek B:1-106 [80430]
   Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb1, d1nekc_, d1nekd_
   complexed with ca, cdn, eph, f3s, fad, fes, fs4, hem, oaa, uq2

Details for d1nekb2

PDB Entry: 1nek, 2.6 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound

SCOP Domain Sequences for d1nekb2:

Sequence; same for both SEQRES and ATOM records:

>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli}
mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc
gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd

Timeline for d1nekb2:

• d1nekb2 first appeared in SCOP 1.63
  
• d1nekb2 appears in SCOP 1.69
  
• d1nekb2 appears in SCOP 1.73
  
• d1nekb2 appears in the current release, SCOPe 2.08