![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (11 proteins) |
![]() | Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [82587] (2 PDB entries) |
![]() | Domain d1nekb2: 1nek B:1-106 [80430] Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb1, d1nekc_, d1nekd_ |
PDB Entry: 1nek (more details), 2.6 Å
SCOP Domain Sequences for d1nekb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli} mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd
Timeline for d1nekb2: