Lineage for d1nekb1 (1nek B:107-238)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1256293Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1256294Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 1256325Protein Succinate dehydogenase [81669] (1 species)
  7. 1256326Species Escherichia coli [TaxId:562] [81670] (6 PDB entries)
  8. 1256336Domain d1nekb1: 1nek B:107-238 [80429]
    Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb2, d1nekc_, d1nekd_
    complexed with ca, cdn, eph, f3s, fad, fes, hem, oaa, sf4, uq2

Details for d1nekb1

PDB Entry: 1nek (more details), 2.6 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound
PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOPe Domain Sequences for d1nekb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOPe Domain Coordinates for d1nekb1:

Click to download the PDB-style file with coordinates for d1nekb1.
(The format of our PDB-style files is described here.)

Timeline for d1nekb1: