Lineage for d1nekb1 (1nek B:107-238)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 531937Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
    contains two Fe4-S4 clusters
  5. 531938Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)
  6. 531956Protein Succinate dehydogenase [81669] (1 species)
  7. 531957Species Escherichia coli [TaxId:562] [81670] (2 PDB entries)
  8. 531958Domain d1nekb1: 1nek B:107-238 [80429]
    Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb2, d1nekc_, d1nekd_
    complexed with ca, cdn, eph, f3s, fad, fes, fs4, hem, oaa, uq2

Details for d1nekb1

PDB Entry: 1nek (more details), 2.6 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound

SCOP Domain Sequences for d1nekb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOP Domain Coordinates for d1nekb1:

Click to download the PDB-style file with coordinates for d1nekb1.
(The format of our PDB-style files is described here.)

Timeline for d1nekb1: