Lineage for d1neka3 (1nek A:236-355)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737821Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 737822Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 737823Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 737890Protein Succinate dehydogenase [82818] (1 species)
  7. 737891Species Escherichia coli [TaxId:562] [82819] (2 PDB entries)
  8. 737892Domain d1neka3: 1nek A:236-355 [80428]
    Other proteins in same PDB: d1neka1, d1neka2, d1nekb1, d1nekb2, d1nekc_, d1nekd_
    complexed with ca, cdn, eph, f3s, fad, fes, fs4, hem, oaa, uq2

Details for d1neka3

PDB Entry: 1nek (more details), 2.6 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound
PDB Compounds: (A:) Succinate dehydrogenase flavoprotein subunit

SCOP Domain Sequences for d1neka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1neka3 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
memwqfhptgiagagvlvtegcrgeggyllnkhgerfmeryapnakdlagrdvvarsimi
eiregrgcdgpwgphaklkldhlgkevlesrlpgilelsrtfahvdpvkepipviptchy

SCOP Domain Coordinates for d1neka3:

Click to download the PDB-style file with coordinates for d1neka3.
(The format of our PDB-style files is described here.)

Timeline for d1neka3: