SCOPe 2.06: Domain d1ne8a1: 1ne8 A:2-116

Lineage for d1ne8a1 (1ne8 A:2-116)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein PemK-like protein YdcE [82078] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [82079] (1 PDB entry)

8. Domain d1ne8a1: 1ne8 A:2-116 [80424]
   Other proteins in same PDB: d1ne8a2
   complexed with 1pg, acy

Details for d1ne8a1

PDB Entry: 1ne8, 2.1 Å

PDB Description: ydce protein from bacillus subtilis

PDB Compounds: (A:) conserved hypothetical protein YDCE

SCOPe Domain Sequences for d1ne8a1:

Sequence; same for both SEQRES and ATOM records:

>d1ne8a1 b.34.6.2 (A:2-116) PemK-like protein YdcE {Bacillus subtilis [TaxId: 1423]}
ivkrgdvyfadlspvvgseqggvrpvlviqndignrfsptaivaaitaqiqkaklpthve
idakrygferdsvilleqirtidkqrltdkithlddemmdkvdealqislalidf

Timeline for d1ne8a1:

• d1ne8a1 first appeared in SCOP 1.63, called d1ne8a_
  
• d1ne8a1 was called d1ne8a_ in SCOPe 2.05
  
• d1ne8a1 appears in SCOPe 2.07
  
• d1ne8a1 appears in the current release, SCOPe 2.08