Lineage for d1ndea_ (1nde A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2335387Protein Estrogen receptor beta [48521] (2 species)
  7. 2335388Species Human (Homo sapiens) [TaxId:9606] [48522] (27 PDB entries)
  8. 2335440Domain d1ndea_: 1nde A: [80415]
    complex with selective triazine modulator
    complexed with mon

Details for d1ndea_

PDB Entry: 1nde (more details), 3 Å

PDB Description: estrogen receptor beta with selective triazine modulator
PDB Compounds: (A:) Estrogen receptor beta

SCOPe Domain Sequences for d1ndea_:

Sequence, based on SEQRES records: (download)

>d1ndea_ a.123.1.1 (A:) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl

Sequence, based on observed residues (ATOM records): (download)

>d1ndea_ a.123.1.1 (A:) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
dalspeqlvltlleaepphvlisrpsfteasmmmsltkladkelvhmiswakkipgfvel
slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
ttsrfrelklqhkeylcvkamillnssmyatqdadssrklahllnavtdalvwviaksgi
ssqqqsmrlanllmllshvrhasnkgmehllnmkckpvydlllemlnahvl

SCOPe Domain Coordinates for d1ndea_:

Click to download the PDB-style file with coordinates for d1ndea_.
(The format of our PDB-style files is described here.)

Timeline for d1ndea_: