Lineage for d1ndba1 (1ndb A:30-405)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244530Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 244531Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families) (S)
  5. 244575Family c.43.1.3: Carnitine acetyltransferase [82424] (1 protein)
    monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 244576Protein Carnitine acetyltransferase [82425] (1 species)
    relative spatial position of the domains is similar to the monomers in CAT trimer
  7. 244577Species Mouse (Mus musculus) [TaxId:10090] [82426] (3 PDB entries)
  8. 244578Domain d1ndba1: 1ndb A:30-405 [80411]

Details for d1ndba1

PDB Entry: 1ndb (more details), 1.8 Å

PDB Description: crystal structure of carnitine acetyltransferase

SCOP Domain Sequences for d1ndba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndba1 c.43.1.3 (A:30-405) Carnitine acetyltransferase {Mouse (Mus musculus)}
ahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkgler
rakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegvldf
ksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvvhny
qffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnlikd
kvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdktlqf
ivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnitpei
kndiekakqnlsimiq

SCOP Domain Coordinates for d1ndba1:

Click to download the PDB-style file with coordinates for d1ndba1.
(The format of our PDB-style files is described here.)

Timeline for d1ndba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ndba2