SCOPe 2.06: Domain d1nd6c_: 1nd6 C:

Lineage for d1nd6c_ (1nd6 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.2: Histidine acid phosphatase [53258] (4 proteins)

6. Protein Prostatic acid phosphatase [53259] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53261] (4 PDB entries)

8. Domain d1nd6c_: 1nd6 C: [80409]
   complexed with 1pe, gly, nag, po4

Details for d1nd6c_

PDB Entry: 1nd6, 2.4 Å

PDB Description: crystal structures of human prostatic acid phosphatase in complex with a phosphate ion and alpha-benzylaminobenzylphosphonic acid update the mechanistic picture and offer new insights into inhibitor design

PDB Compounds: (C:) prostatic acid phosphatase

SCOPe Domain Sequences for d1nd6c_:

Sequence; same for both SEQRES and ATOM records:

>d1nd6c_ c.60.1.2 (C:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]}
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt

Timeline for d1nd6c_:

• d1nd6c_ first appeared in SCOP 1.63
  
• d1nd6c_ appears in SCOPe 2.05
  
• d1nd6c_ appears in SCOPe 2.07
  
• d1nd6c_ appears in the current release, SCOPe 2.08