SCOP 1.65: Domain d1nbwd_: 1nbw D:

Lineage for d1nbwd_ (1nbw D:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.3: B12-dependend dehydatases associated subunit [52968] (2 families)

5. Family c.51.3.2: Glycerol dehydratase reactivase, beta subunit [82433] (1 protein)

6. Protein Glycerol dehydratase reactivase, beta subunit [82434] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [82435] (1 PDB entry)

8. Domain d1nbwd_: 1nbw D: [80400]
   Other proteins in same PDB: d1nbwa1, d1nbwa2, d1nbwa3, d1nbwc1, d1nbwc2, d1nbwc3
   complexed with ca

Details for d1nbwd_

PDB Entry: 1nbw, 2.4 Å

PDB Description: Glycerol dehydratase reactivase

SCOP Domain Sequences for d1nbwd_:

Sequence; same for both SEQRES and ATOM records:

>d1nbwd_ c.51.3.2 (D:) Glycerol dehydratase reactivase, beta subunit {Klebsiella pneumoniae}
ppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarssplrvgi
glsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern

Timeline for d1nbwd_:

• d1nbwd_ first appeared in SCOP 1.63
  
• d1nbwd_ appears in SCOP 1.67
  
• d1nbwd_ appears in the current release, SCOPe 2.08