Lineage for d1nbwc1 (1nbw C:92-256)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310107Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (7 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 310298Superfamily c.8.6: Swiveling domain of the glycerol dehydratase reactivase alpha subunit [82317] (1 family) (S)
  5. 310299Family c.8.6.1: Swiveling domain of the glycerol dehydratase reactivase alpha subunit [82318] (1 protein)
  6. 310300Protein Swiveling domain of the glycerol dehydratase reactivase alpha subunit [82319] (1 species)
  7. 310301Species Klebsiella pneumoniae [TaxId:573] [82320] (1 PDB entry)
  8. 310303Domain d1nbwc1: 1nbw C:92-256 [80397]
    Other proteins in same PDB: d1nbwa2, d1nbwa3, d1nbwb_, d1nbwc2, d1nbwc3, d1nbwd_
    complexed with ca

Details for d1nbwc1

PDB Entry: 1nbw (more details), 2.4 Å

PDB Description: Glycerol dehydratase reactivase

SCOP Domain Sequences for d1nbwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbwc1 c.8.6.1 (C:92-256) Swiveling domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae}
itestmighnpqtpggvgvgvgttialgrlatlpaaqyaegwivliddavdfldavwwln
ealdrginvvaailkkddgvlvnnrlrktlpvvdevtlleqvpegvmaavevaapgqvvr
ilsnpygiatffglspeetqaivpiaralignrsavvlktpqgdv

SCOP Domain Coordinates for d1nbwc1:

Click to download the PDB-style file with coordinates for d1nbwc1.
(The format of our PDB-style files is described here.)

Timeline for d1nbwc1: