Lineage for d1nbpa_ (1nbp A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266371Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1266372Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1266458Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1266504Protein Interleukin-2 (IL-2) [47301] (1 species)
  7. 1266505Species Human (Homo sapiens) [TaxId:9606] [47302] (15 PDB entries)
  8. 1266511Domain d1nbpa_: 1nbp A: [80392]
    complexed with mhc, so4

Details for d1nbpa_

PDB Entry: 1nbp (more details), 2.2 Å

PDB Description: crystal structure of human interleukin-2 y31c covalently modified at c31 with 3-mercapto-1-(1,3,4,9-tetrahydro-b-carbolin-2-yl)-propan-1- one
PDB Compounds: (A:) interleukin-2

SCOPe Domain Sequences for d1nbpa_:

Sequence, based on SEQRES records: (download)

>d1nbpa_ a.26.1.2 (A:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginncknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfc
qsiistlt

Sequence, based on observed residues (ATOM records): (download)

>d1nbpa_ a.26.1.2 (A:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginncknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqfhlrprdlisninvivlelkgfmceyadetativeflnrwitfcqsiistl
t

SCOPe Domain Coordinates for d1nbpa_:

Click to download the PDB-style file with coordinates for d1nbpa_.
(The format of our PDB-style files is described here.)

Timeline for d1nbpa_: