Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82570] (2 PDB entries) |
Domain d1nbfe_: 1nbf E: [80391] Other proteins in same PDB: d1nbfc_, d1nbfd_ complex with ubiquitin aldehyde |
PDB Entry: 1nbf (more details), 2.3 Å
SCOPe Domain Sequences for d1nbfe_:
Sequence, based on SEQRES records: (download)
>d1nbfe_ d.3.1.9 (E:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqk
>d1nbfe_ d.3.1.9 (E:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq eaekgvkfltlppvlhlqlmrfmnikindrfefpeqlpldeflqktdpkdpanyilhavl vhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsvrhctnay mlvyiresklsevlqavtdhdipqqlverlqeekrieaqk
Timeline for d1nbfe_:
View in 3D Domains from other chains: (mouse over for more information) d1nbfa_, d1nbfb_, d1nbfc_, d1nbfd_ |