Lineage for d1nb8b_ (1nb8 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155259Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 protein domains)
    Pfam PF00443
  6. 2155273Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species)
  7. 2155274Species Human (Homo sapiens) [TaxId:9606] [82570] (2 PDB entries)
  8. 2155279Domain d1nb8b_: 1nb8 B: [80386]

Details for d1nb8b_

PDB Entry: 1nb8 (more details), 2.3 Å

PDB Description: Structure of the catalytic domain of USP7 (HAUSP)
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 7

SCOPe Domain Sequences for d1nb8b_:

Sequence, based on SEQRES records: (download)

>d1nb8b_ d.3.1.9 (B:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan
yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv
rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqkr

Sequence, based on observed residues (ATOM records): (download)

>d1nb8b_ d.3.1.9 (B:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
eaekgvkfltlppvlhlqlmrfmikindrfefpeqlpldeflqktdpkdpanyilhavlv
hsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghhctnaymlvyires
klsevlqavtdhdipqqlverlqeekrieaqkr

SCOPe Domain Coordinates for d1nb8b_:

Click to download the PDB-style file with coordinates for d1nb8b_.
(The format of our PDB-style files is described here.)

Timeline for d1nb8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nb8a_