Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82570] (25 PDB entries) |
Domain d1nb8a_: 1nb8 A: [80385] |
PDB Entry: 1nb8 (more details), 2.3 Å
SCOPe Domain Sequences for d1nb8a_:
Sequence, based on SEQRES records: (download)
>d1nb8a_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqk
>d1nb8a_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq eaekgvkfltlppvlhlqlmrfmikindrfefpeqlpldeflqktdpkdpanyilhavlv hsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghhctnaymlvyires klsevlqavtdhdipqqlverlqeekrieaqk
Timeline for d1nb8a_: