SCOPe 2.06: Domain d1nb5k_: 1nb5 K:

Lineage for d1nb5k_ (1nb5 K:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein Cystatin A (stefin A) [54412] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54413] (12 PDB entries)

8. Domain d1nb5k_: 1nb5 K: [80383]
   Other proteins in same PDB: d1nb5.1, d1nb5.2, d1nb5.3, d1nb5.4

Details for d1nb5k_

PDB Entry: 1nb5, 2.4 Å

PDB Description: crystal structure of stefin a in complex with cathepsin h

PDB Compounds: (K:) stefin a

SCOPe Domain Sequences for d1nb5k_:

Sequence; same for both SEQRES and ATOM records:

>d1nb5k_ d.17.1.2 (K:) Cystatin A (stefin A) {Human (Homo sapiens) [TaxId: 9606]}
mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf

Timeline for d1nb5k_:

• d1nb5k_ first appeared in SCOP 1.63
  
• d1nb5k_ appears in SCOPe 2.05
  
• d1nb5k_ appears in SCOPe 2.07
  
• d1nb5k_ appears in the current release, SCOPe 2.08